PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G232800.1.p
Common NameSb03g029050, SORBIDRAFT_03g029050
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 294aa    MW: 32130.4 Da    PI: 7.4966
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G232800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-172471148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT eEd++lv ++ q+G g+W+  ar  g++R +k+c++rw++yl
  Sobic.003G232800.1.p 24 KGPWTLEEDLILVSYISQHGEGSWDNLARSAGLNRNGKSCRLRWLNYL 71
                          79********************************************97 PP

2Myb_DNA-binding42.71.3e-1377120146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           rg+ T+ Ed  + ++++++G++ W++I++ ++ gRt++++k++w++
  Sobic.003G232800.1.p  77 RGSITAGEDTVIRELHARWGNK-WSKISKQLP-GRTDNEIKNYWRT 120
                           6788999***************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.2221975IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-201974IPR009057Homeodomain-like
SuperFamilySSF466898.58E-3022118IPR009057Homeodomain-like
SMARTSM007173.5E-142373IPR001005SANT/Myb domain
PfamPF002491.9E-152471IPR001005SANT/Myb domain
CDDcd001673.00E-112671No hitNo description
Gene3DG3DSA:1.10.10.603.6E-2275125IPR009057Homeodomain-like
SMARTSM007172.3E-1176124IPR001005SANT/Myb domain
PROSITE profilePS5129419.12576126IPR017930Myb domain
PfamPF002494.2E-1277120IPR001005SANT/Myb domain
CDDcd001673.29E-981120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MTTTTTRVAS SRSCGGDDEP AVRKGPWTLE EDLILVSYIS QHGEGSWDNL ARSAGLNRNG  60
KSCRLRWLNY LRPGVRRGSI TAGEDTVIRE LHARWGNKWS KISKQLPGRT DNEIKNYWRT  120
RIQKKKKQHQ APMATTTSTQ QQQQEQEPST TTVSSGGATG DYYWCTKPAD PDLQQQQAYY  180
CQKAAMAAAA TTNNVNAVAV SSEGAGASSP AALTMSQDSS TAAGDWYTQH QQTTTYPYYC  240
SELSLVAGGG HGETTAGLDA LTMQFLSSHF TASFWTNGSV DDFWETKPIT DAF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-262012523127MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7281931e-157KJ728193.1 Zea mays clone pUT6467 MYB transcription factor (MYB53) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456023.10.0hypothetical protein SORBIDRAFT_03g029050
SwissprotP813911e-59MYB05_ANTMA; Myb-related protein 305
TrEMBLC5XEI80.0C5XEI8_SORBI; Putative uncharacterized protein Sb03g029050
STRINGSb03g029050.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132402633
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.16e-58myb domain protein 21